Degradation pathway of sphingolipids, including diseases (WP4153)
Homo sapiens
The degradation of SphingoLipids (SLs) occurs through a series of specific hydrolases in the lysosome, after the compounds have been transported via the endosomal pathway. Disorders resulting from an enzyme defect are highlighted in pink. Hydrolase defects result in accumulation and lysosomal storage of substrates, leading to cell pathology. This pathway was inspired by Edition 5, Chapter 60 of the book of Blau (ISBN 9783030677268); Ed.4 Ch.25. Proteins on this pathway have targeted assays available via the CPTAC Assay Portal.
For a description of pathway objects, see the WikiPathways Legend.
Authors
Activity
Discuss this pathway
Check for ongoing discussions or start your own.
Cited In
Are you planning to include this pathway in your next publication? See How to Cite and add a link here to your paper once it's online.
Organisms
Homo sapiensCommunities
Inherited Metabolic Disorders (IMD) Pathways ONTOX Rare DiseasesAnnotations
Disease Ontology
gangliosidosis Krabbe disease Niemann-Pick disease Fabry disease GM2 gangliosidosis Sandhoff disease GM1 gangliosidosis disease GM2 gangliosidosis, AB variant Farber lipogranulomatosis metachromatic leukodystrophy Tay-Sachs disease Niemann-Pick disease type A Niemann-Pick disease type B Gaucher's diseasePathway Ontology
sphingolipid biosynthetic pathway disease pathway sphingolipid metabolic pathway lacto-series glycosphingolipid metabolic pathway sphingolipid degradation pathway altered sphingolipid metabolic pathway glycosphingolipid metabolic pathwayLabel | Type | Compact URI | Comment |
---|---|---|---|
Digalactosylceramide | Metabolite | chebi:134506 | AKA Gal-α(1-4)-Gal-Cer |
Digalactosylceramide beta | Metabolite | chebi:134507 | |
Globoside | Metabolite | chebi:61360 | AKA GalNAc -ß(1-3)Gal-Glc-Cer |
Globoside example 1 | Metabolite | chebi:88167 | N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1->1')-ceramide |
globotriaosylceramide | Metabolite | pubchem.compound:66616222 | also known as CD77, Gb3, and ceramide trihexosideAKA Gal-α(1-4)-Gal-Glc-Cer |
Globoside example 2 | Metabolite | chebi:18259 | N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1->1')-N-acylsphing-4-enine |
Digalactosylceramide alpha | Metabolite | chebi:134506 | alpha-D-galactosyl-(1->4)-beta-D-galactosyl-N-(pentacosanoyl)sphingosine |
GA2 | Metabolite | chebi:27731 | ganglioside GA2AKA GalNAc-ß-(1-4)-Gal-Glc-Cer |
GM3 | Metabolite | chebi:79210 | ganglioside GM3AKA Α(2,3)NeuAc-Gal-ß(1-4)-Glc-Cer |
Ceramide | Metabolite | chebi:17761 | |
Sphingosine | Metabolite | wikidata:Q46298 | |
galactosyl-ceramide | Metabolite | wikidata:Q2756638 | GalactocerebrosideAKA Gal-ß(1-1)-Cer |
Sphingomyelin | Metabolite | wikidata:Q423143 | |
Glucosylceramide | Metabolite | wikidata:Q35662896 | AKA Glc-ß(1-1)-Cer |
Sulfatide | Metabolite | wikidata:Q408584 | AKA O 3 S-3-Gal-Cer |
lactosylceramide | Metabolite | wikidata:Q3215908 | AKA Gal-ß(1-4)-Glc-Cer |
GM2 | Metabolite | chebi:79218 | ganglioside GM2AKA GalNAc-ß(1-4)-Gal[NeuAc]-Glc-Cer |
GM1 | Metabolite | chebi:18216 | aka ganglioside GM1a, GM1aAKA Gal-ß(1-3)-GalNAc-Gal[NeuAc]-Glc-Cer |
GA1 | Metabolite | chebi:27938 | ganglioside GA1AKA Gal-ß(1-3)-GalNAc-Gal-Glc-Cer |
SCARB2 | GeneProduct | ncbigene:950 | AKA scavenger receptor class B, member 2/ lysosomal intergral membrane protein 2 |
PSAP | GeneProduct | ncbigene:5660 | |
GLB1 | GeneProduct | ensembl:ENSG00000170266 | GM1-beta-galactosidase 1 |
NPC1 | GeneProduct | ncbigene:4864 | AKA scavenger receptor class B, member 2/ lysosomal intergral membrane protein 2 |
NPC2 | GeneProduct | ncbigene:10577 | AKA scavenger receptor class B, member 2/ lysosomal intergral membrane protein 2 |
LIPA | GeneProduct | ensembl:ENSG00000107798 | AKA scavenger receptor class B, member 2/ lysosomal intergral membrane protein 2 |
HEXB | Protein | uniprot:P07686 | |
GM1-beta-galactosidase (GLB): | Protein | eccode:3.2.1.23 | |
Sap-B | Protein | interpro:IPR008139 | SaposinB |
HEXA | Protein | uniprot:P06865 | Hexosaminidase A; HEXA and the cofactor GM2 activator protein catalyze the degradation of the GM2 gangliosides |
Sialidase 2 | Protein | uniprot:Q9Y3R4 | |
Acrylsulfatase A | Protein | ensembl:ENSG00000100299 | Arylsulfatase A (or cerebroside-sulfatase) |
Sialidase 1 | Protein | uniprot:Q99519 | |
Sphingomyelinase | Protein | eccode:3.1.4.12 | Sphingomyelin phosphodiesterase (also known as neutral sphingomyelinase, sphingomyelinase, or SMase) |
Sialidase | Protein | interpro:IPR004124 | |
Glucosylceramide-beta-glucosidase | Protein | uniprot:P04062 | Based on disorder (Goucher), this enzyme is assumed to be GBA) |
GM2A | Protein | ncbigene:2760 | GM2-Activator |
Beta-hexosaminidase A, B: | Protein | eccode:3.2.1.52 | |
Alpha-galactosidase A | Protein | ncbigene:2717 | |
Sialidase 3 | Protein | uniprot:Q9UQ49 | |
Acid ceramidase | Protein | eccode:3.5.1.23 | Acid ceramidase (N-acylsphingosine deacylase, ASAH1) |
GalCer-beta-galactosidase | Protein | eccode:3.2.1.46 | GALCERase |
Sialidase 4 | Protein | uniprot:Q8WWR8 | |
HEXA | Protein | ensembl:ENSG00000213614 | |
GM2-activator | Protein | ncbigene:2760 | |
Sap-B | Protein | uniprot:P07602 | Sap-B is assumed to represent Saposin-B, which 'stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.' Source: https://www.uniprot.org/uniprotkb/P07602/entryAlternative names: Cerebroside sulfate activator (CSAct) DispersinSphingolipid activator protein 1 (SAP-1) Sulfatide/GM1 activator |
GM1-beta-galactosidease (GLB): | Protein | eccode:3.2.1.23 | |
Sap-B | Protein | interpro:IPR008139 | |
Sap-C | Protein | uniprot:P07602 | Sap-C is assumed to represent Saposin-C, which ' stimulates the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.' Source:[https://www.uniprot.org/uniprotkb/P07602/entry]'Saposin C is one of four homologous proteins derived from sequential cleavage of the saposin precursor protein, prosaposin.' [PMID:22652185]Alternative names: A1 activatorCo-beta-glucosidaseGlucosylceramidase activatorSphingolipid activator protein 2 (SAP-2)Amino acid sequence of saposin C: C'-SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG-N' [PMID:22652185] |
Sap-C | Protein | uniprot:P07602 | Sap-C is assumed to represent Saposin-C, which ' stimulates the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.' Source:[https://www.uniprot.org/uniprotkb/P07602/entry]Alternative names: A1 activatorCo-beta-glucosidaseGlucosylceramidase activatorSphingolipid activator protein 2 (SAP-2) |
Sap-C | Protein | uniprot:P07602 | Sap-C is assumed to represent Saposin-C, which ' stimulates the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.' Source:[https://www.uniprot.org/uniprotkb/P07602/entry]Alternative names: A1 activatorCo-beta-glucosidase Glucosylceramidase activator Sphingolipid activator protein 2 (SAP-2) |
Glucosylceramide-beta-glucosidase | Protein | uniprot:P54803 | Based on disorder (Krabbe), this enzyme is assumed to be GALC) |
Sap-A | Protein | interpro:IPR003119 |
References
- NAG-thiazoline, An N-Acetyl-β-hexosaminidase Inhibitor That Implicates Acetamido Participation. Knapp S, Vocadlo D, Gao Z, Kirk B, Lou J, Withers SG. J Am Chem Soc [Internet]. 1996 Jan 1;118(28):6804–5. Available from: http://dx.doi.org/10.1021/ja960826u DOI Scholia
- Physician’s Guide to the Diagnosis, Treatment, and Follow-Up of Inherited Metabolic Diseases [Internet]. Blau N, Duran M, Gibson KM, Dionisi-Vici C. Springer; 2014. 0 p. Available from: https://books.google.com/books/about/Physician_s_Guide_to_the_Diagnosis_Treat.html?hl=&id=wJRBnwEACAAJ OpenLibrary Worldcat
- Classification of disorders of GM2 ganglioside hydrolysis using 3H-GM2 as substrate. Novak A, Callahan JW, Lowden JA. Biochim Biophys Acta. 1994 Mar 2;1199(2):215–23. PubMed Europe PMC Scholia
- Direct determination of the substrate specificity of the alpha-active site in heterodimeric beta-hexosaminidase A. Hou Y, Tse R, Mahuran DJ. Biochemistry. 1996 Apr 2;35(13):3963–9. PubMed Europe PMC Scholia
- A family of human beta3-galactosyltransferases. Characterization of four members of a UDP-galactose:beta-N-acetyl-glucosamine/beta-nacetyl-galactosamine beta-1,3-galactosyltransferase family. Amado M, Almeida R, Carneiro F, Levery SB, Holmes EH, Nomoto M, et al. J Biol Chem. 1998 May 22;273(21):12770–8. PubMed Europe PMC Scholia
- A Pro504 --> Ser substitution in the beta-subunit of beta-hexosaminidase A inhibits alpha-subunit hydrolysis of GM2 ganglioside, resulting in chronic Sandhoff disease. Hou Y, McInnes B, Hinek A, Karpati G, Mahuran D. J Biol Chem. 1998 Aug 14;273(33):21386–92. PubMed Europe PMC Scholia
- Combinatorial ganglioside biosynthesis. Kolter T, Proia RL, Sandhoff K. J Biol Chem. 2002 Jul 19;277(29):25859–62. PubMed Europe PMC Scholia
- Sphingolipid metabolism diseases. Kolter T, Sandhoff K. Biochim Biophys Acta. 2006 Dec;1758(12):2057–79. PubMed Europe PMC Scholia
- Principles of lysosomal membrane degradation: Cellular topology and biochemistry of lysosomal lipid degradation. Schulze H, Kolter T, Sandhoff K. Biochim Biophys Acta. 2009 Apr;1793(4):674–83. PubMed Europe PMC Scholia
- The role of saposin C in Gaucher disease. Tamargo RJ, Velayati A, Goldin E, Sidransky E. Mol Genet Metab. 2012 Jul;106(3):257–63. PubMed Europe PMC Scholia